Lineage for d4ilgb_ (4ilg B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860153Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 protein domains)
    automatically mapped to Pfam PF12134
  6. 1860154Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (3 species)
  7. 1860155Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
    Uniprot P33334 1833-2087! Uniprot P33334 1835-2087
  8. 1860158Domain d4ilgb_: 4ilg B: [196659]
    Other proteins in same PDB: d4ilgc_
    automated match to d3e9oa1
    complexed with epe

Details for d4ilgb_

PDB Entry: 4ilg (more details), 2.1 Å

PDB Description: Crystal structure of Aar2p in complex with the Prp8p RNaseH and Jab1/MPN domains
PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4ilgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilgb_ c.55.3.14 (B:) Pre-mRNA-splicing factor 8, Prp8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
amnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflki
ihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpn
iairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllr
alktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisa
ltqteikdiilg

SCOPe Domain Coordinates for d4ilgb_:

Click to download the PDB-style file with coordinates for d4ilgb_.
(The format of our PDB-style files is described here.)

Timeline for d4ilgb_: