SCOPe 2.05: Domain d4ilgb_: 4ilg B:

Lineage for d4ilgb_ (4ilg B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins)
   automatically mapped to Pfam PF12134

6. Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
   Uniprot P33334 1833-2087! Uniprot P33334 1835-2087

8. Domain d4ilgb_: 4ilg B: [196659]
   Other proteins in same PDB: d4ilgc_
   automated match to d3e9oa1
   complexed with epe

Details for d4ilgb_

PDB Entry: 4ilg, 2.1 Å

PDB Description: Crystal structure of Aar2p in complex with the Prp8p RNaseH and Jab1/MPN domains

PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4ilgb_:

Sequence; same for both SEQRES and ATOM records:

>d4ilgb_ c.55.3.14 (B:) Pre-mRNA-splicing factor 8, Prp8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
amnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflki
ihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpn
iairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllr
alktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisa
ltqteikdiilg

Timeline for d4ilgb_:

• d4ilgb_ first appeared in SCOPe 2.02
  
• d4ilgb_ appears in SCOPe 2.04
  
• d4ilgb_ is called d4ilgb1 in SCOPe 2.06
  
• d4ilgb_ appears in the current release, SCOPe 2.08, called d4ilgb1