Lineage for d4ilgb1 (4ilg B:1836-2085)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2463945Family c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
    automatically mapped to Pfam PF12134
  6. 2463946Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species)
  7. 2463947Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
    Uniprot P33334 1833-2087! Uniprot P33334 1835-2087
  8. 2463950Domain d4ilgb1: 4ilg B:1836-2085 [196659]
    Other proteins in same PDB: d4ilga1, d4ilga2, d4ilgb2, d4ilgc_
    automated match to d3e9oa1
    complexed with epe

Details for d4ilgb1

PDB Entry: 4ilg (more details), 2.1 Å

PDB Description: Crystal structure of Aar2p in complex with the Prp8p RNaseH and Jab1/MPN domains
PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d4ilgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ilgb1 c.55.3.14 (B:1836-2085) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflkiih
tsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfpnia
irptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlllral
ktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnisalt
qteikdiilg

SCOPe Domain Coordinates for d4ilgb1:

Click to download the PDB-style file with coordinates for d4ilgb1.
(The format of our PDB-style files is described here.)

Timeline for d4ilgb1: