SCOPe 2.04: Domain d3zhwa_: 3zhw A:

Lineage for d3zhwa_ (3zhw A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [196657] (1 PDB entry)

8. Domain d3zhwa_: 3zhw A: [196658]
   automated match to d2oifg_
   complexed with hem, so4

Details for d3zhwa_

PDB Entry: 3zhw, 2.22 Å

PDB Description: X-ray Crystallographic Structural Characteristics of Arabidopsis Hemoglobin I and their Functional Implications

PDB Compounds: (A:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d3zhwa_:

Sequence; same for both SEQRES and ATOM records:

>d3zhwa_ a.1.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
kivfteeqealvvkswsvmkknsaelglklfikifeiapttkkmfsflrdspipaeqnpk
lkphamsvfvmccesavqlrktgkvtvrettlkrlgashskygvvdehfevakyalleti
keavpemwspemkvawgqaydhlvaaikaemnls

Timeline for d3zhwa_:

• d3zhwa_ first appeared in SCOPe 2.02
  
• d3zhwa_ appears in SCOPe 2.03
  
• d3zhwa_ appears in SCOPe 2.05
  
• d3zhwa_ appears in the current release, SCOPe 2.08