Lineage for d4il6u_ (4il6 U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716633Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2716634Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2716639Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)
  8. 2716646Domain d4il6u_: 4il6 U: [196656]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6v_, d4il6x_, d4il6z_
    automated match to d3arcu_
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6u_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d4il6u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6u_ a.60.12.2 (U:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d4il6u_:

Click to download the PDB-style file with coordinates for d4il6u_.
(The format of our PDB-style files is described here.)

Timeline for d4il6u_: