| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein automated matches [190113] (17 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [189921] (1 PDB entry) |
| Domain d4il6v_: 4il6 V: [196655] Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6x_, d4il6z_ automated match to d3bz2v_ complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl |
PDB Entry: 4il6 (more details), 2.1 Å
SCOPe Domain Sequences for d4il6v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il6v_ a.3.1.1 (V:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy
Timeline for d4il6v_: