Lineage for d1f22a_ (1f22 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016605Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2016606Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2016607Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2016664Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 2016665Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries)
  8. 2016672Domain d1f22a_: 1f22 A: [19665]
    complexed with hec

Details for d1f22a_

PDB Entry: 1f22 (more details)

PDB Description: a proton-nmr investigation of the fully reduced cytochrome c7 from desulfuromonas acetoxidans. comparison between the reduced and the oxidized forms.
PDB Compounds: (A:) cytochrome c7

SCOPe Domain Sequences for d1f22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f22a_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans [TaxId: 891]}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

SCOPe Domain Coordinates for d1f22a_:

Click to download the PDB-style file with coordinates for d1f22a_.
(The format of our PDB-style files is described here.)

Timeline for d1f22a_: