Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein automated matches [191000] (6 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries) |
Domain d4il6f_: 4il6 F: [196642] Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_ automated match to d2axtf1 complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl |
PDB Entry: 4il6 (more details), 2.1 Å
SCOPe Domain Sequences for d4il6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il6f_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} sypiftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d4il6f_: