Lineage for d3zdgf_ (3zdg F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073887Protein automated matches [190922] (2 species)
    not a true protein
  7. 2073888Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)
  8. 2073901Domain d3zdgf_: 3zdg F: [196628]
    Other proteins in same PDB: d3zdga_, d3zdgb_, d3zdgc_, d3zdgh_, d3zdgi_, d3zdgj_, d3zdgk_, d3zdgl_, d3zdgm_, d3zdgn_, d3zdgo_, d3zdgp_, d3zdgq_, d3zdgr_, d3zdgs_, d3zdgt_
    automated match to d3u8jb_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdgf_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: Crystal Structure of Ls-AChBP complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (DMABC)
PDB Compounds: (F:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdgf_:

Sequence, based on SEQRES records: (download)

>d3zdgf_ b.96.1.1 (F:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d3zdgf_ b.96.1.1 (F:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3zdgf_:

Click to download the PDB-style file with coordinates for d3zdgf_.
(The format of our PDB-style files is described here.)

Timeline for d3zdgf_: