Lineage for d3zdge_ (3zdg E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408112Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2408206Protein automated matches [190922] (2 species)
    not a true protein
  7. 2408207Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (33 PDB entries)
  8. 2408219Domain d3zdge_: 3zdg E: [196627]
    Other proteins in same PDB: d3zdga_, d3zdgb_, d3zdgc_, d3zdgh_, d3zdgi_, d3zdgj_, d3zdgk_, d3zdgl_, d3zdgm_, d3zdgn_, d3zdgo_, d3zdgp_, d3zdgq_, d3zdgr_, d3zdgs_, d3zdgt_
    automated match to d3u8jb_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdge_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: crystal structure of ls-achbp complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (dmabc)
PDB Compounds: (E:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdge_:

Sequence, based on SEQRES records: (download)

>d3zdge_ b.96.1.1 (E:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d3zdge_ b.96.1.1 (E:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkk

SCOPe Domain Coordinates for d3zdge_:

Click to download the PDB-style file with coordinates for d3zdge_.
(The format of our PDB-style files is described here.)

Timeline for d3zdge_: