Lineage for d4gaib_ (4gai B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126115Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1126116Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1126286Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 1126334Protein automated matches [190999] (1 species)
    not a true protein
  7. 1126335Species Human (Homo sapiens) [TaxId:9606] [188735] (6 PDB entries)
  8. 1126338Domain d4gaib_: 4gai B: [196621]
    automated match to d2i1ba_

Details for d4gaib_

PDB Entry: 4gai (more details), 1.49 Å

PDB Description: crystal structure of ebi-005, a chimera of human il-1beta and il-1ra
PDB Compounds: (B:) ebi-005

SCOPe Domain Sequences for d4gaib_:

Sequence, based on SEQRES records: (download)

>d4gaib_ b.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvrslncriwdvnqktfylrnnqlvagylqgpnvnleekfsmsfvqgeesndkipvalg
lkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwf
lctameadqpvsltnmpdegvmvtkfymqfv

Sequence, based on observed residues (ATOM records): (download)

>d4gaib_ b.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvrslncriwdvnqktfylrnnqlvagylqgpnvnleekfsmsfvqipvalglkeknly
lscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwflctamea
dqpvsltnmpmvtkfymqfv

SCOPe Domain Coordinates for d4gaib_:

Click to download the PDB-style file with coordinates for d4gaib_.
(The format of our PDB-style files is described here.)

Timeline for d4gaib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4gaia_