Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein automated matches [190999] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188735] (6 PDB entries) |
Domain d4gaib_: 4gai B: [196621] automated match to d2i1ba_ |
PDB Entry: 4gai (more details), 1.49 Å
SCOPe Domain Sequences for d4gaib_:
Sequence, based on SEQRES records: (download)
>d4gaib_ b.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apvrslncriwdvnqktfylrnnqlvagylqgpnvnleekfsmsfvqgeesndkipvalg lkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwf lctameadqpvsltnmpdegvmvtkfymqfv
>d4gaib_ b.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apvrslncriwdvnqktfylrnnqlvagylqgpnvnleekfsmsfvqipvalglkeknly lscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwflctamea dqpvsltnmpmvtkfymqfv
Timeline for d4gaib_: