Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein automated matches [190999] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188735] (7 PDB entries) |
Domain d4gafa_: 4gaf A: [196620] Other proteins in same PDB: d4gafb1, d4gafb2, d4gafb3 automated match to d2i1ba_ complexed with na, nag |
PDB Entry: 4gaf (more details), 2.15 Å
SCOPe Domain Sequences for d4gafa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gafa_ b.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} apvrslncriwdvnqktfylrnnqlvagylqgpnvnleekfsmsfvqgeesndkipvalg lkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwf lctameadqpvsltnmpdegvmvtkfymqfvs
Timeline for d4gafa_: