Structural Classification of Proteins and ASTRAL release 1.73 (November 2007)
Search SCOP (example):

Lineage for d3cara_ (3car A:)

  1. Root: SCOP 1.73
  2. Class a: All alpha proteins [46456] (258 folds)
  3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. Family a.138.1.1: Cytochrome c3-like [48696] (4 protein domains)
  6. Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. Species Desulfovibrio africanus [TaxId:873] [48701] (2 PDB entries)
  8. Domain d3cara_: 3car A: [19662]
    complexed with ars, cgn, hem, zn

Details for d3cara_

PDB Entry: 3car (more details)
PDB Description: reduced structure of the acidic cytochrome c3 from desulfovi africanus
PDB Compounds: (A:) cytochrome c3

SCOP Domain Sequences for d3cara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cara_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus [TaxId: 873]}
xedmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcs
dchaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn

SCOP Domain Coordinates for d3cara_:

Click to download the PDB-style file with coordinates for d3cara_.
(The format of our PDB-style files is described here.)

Timeline for d3cara_:

d3cara_ appears in SCOP 1.71
d3cara_ appears in SCOP 1.75


d3cara_
(click for larger image)


d3cara_ in context of chain


SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu