Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (13 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:284812] [196618] (2 PDB entries) |
Domain d4ii2c1: 4ii2 C:1-147 [196619] Other proteins in same PDB: d4ii2b1, d4ii2b2, d4ii2c2 automated match to d1z2ua1 complexed with atp, edo, mg, pg0, so4 |
PDB Entry: 4ii2 (more details), 2.2 Å
SCOPe Domain Sequences for d4ii2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ii2c1 d.20.1.1 (C:1-147) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv peiahvyktdrsryelsarewtrkyai
Timeline for d4ii2c1: