SCOPe 2.07: Domain d4ii2c1: 4ii2 C:1-147

Lineage for d4ii2c1 (4ii2 C:1-147)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [196618] (2 PDB entries)

8. Domain d4ii2c1: 4ii2 C:1-147 [196619]
   Other proteins in same PDB: d4ii2b1, d4ii2b2, d4ii2c2
   automated match to d1z2ua1
   complexed with atp, edo, mg, pg0, so4

Details for d4ii2c1

PDB Entry: 4ii2, 2.2 Å

PDB Description: crystal structure of ubiquitin activating enzyme 1 (uba1) in complex with the ub e2 ubc4, ubiquitin, and atp/mg

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 4

SCOPe Domain Sequences for d4ii2c1:

Sequence; same for both SEQRES and ATOM records:

>d4ii2c1 d.20.1.1 (C:1-147) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy
pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv
peiahvyktdrsryelsarewtrkyai

Timeline for d4ii2c1:

• d4ii2c1 first appeared in SCOPe 2.02, called d4ii2c_
  
• d4ii2c1 appears in SCOPe 2.06
  
• d4ii2c1 appears in the current release, SCOPe 2.08