![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (11 species) not a true protein |
![]() | Species Schizosaccharomyces pombe [TaxId:284812] [196618] (1 PDB entry) |
![]() | Domain d4ii2c_: 4ii2 C: [196619] Other proteins in same PDB: d4ii2b_ automated match to d1z2ua1 complexed with atp, edo, mg, pg0, so4 |
PDB Entry: 4ii2 (more details), 2.2 Å
SCOPe Domain Sequences for d4ii2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ii2c_ d.20.1.1 (C:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv peiahvyktdrsryelsarewtrkyaihg
Timeline for d4ii2c_: