SCOPe 2.02: Domain d4ii2c_: 4ii2 C:

Lineage for d4ii2c_ (4ii2 C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (11 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [196618] (1 PDB entry)

8. Domain d4ii2c_: 4ii2 C: [196619]
   Other proteins in same PDB: d4ii2b_
   automated match to d1z2ua1
   complexed with atp, edo, mg, pg0, so4

Details for d4ii2c_

PDB Entry: 4ii2, 2.2 Å

PDB Description: crystal structure of ubiquitin activating enzyme 1 (uba1) in complex with the ub e2 ubc4, ubiquitin, and atp/mg

PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 4

SCOPe Domain Sequences for d4ii2c_:

Sequence; same for both SEQRES and ATOM records:

>d4ii2c_ d.20.1.1 (C:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy
pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv
peiahvyktdrsryelsarewtrkyaihg

Timeline for d4ii2c_:

• d4ii2c_ is new in SCOPe 2.02-stable
  
• d4ii2c_ appears in SCOPe 2.03
  
• d4ii2c_ appears in the current release, SCOPe 2.08, called d4ii2c1