Lineage for d4ii2c1 (4ii2 C:1-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939391Species Schizosaccharomyces pombe [TaxId:284812] [196618] (2 PDB entries)
  8. 2939393Domain d4ii2c1: 4ii2 C:1-147 [196619]
    Other proteins in same PDB: d4ii2b1, d4ii2b2, d4ii2c2
    automated match to d1z2ua1
    complexed with atp, edo, mg, pg0, so4

Details for d4ii2c1

PDB Entry: 4ii2 (more details), 2.2 Å

PDB Description: crystal structure of ubiquitin activating enzyme 1 (uba1) in complex with the ub e2 ubc4, ubiquitin, and atp/mg
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 4

SCOPe Domain Sequences for d4ii2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ii2c1 d.20.1.1 (C:1-147) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
malkrinreladlgkdppssssagpvgddlfhwqatimgpadspyaggvfflsihfptdy
pfkppkvnfttriyhpninsngsicldilrdqwspaltiskvllsisslltdpnpddplv
peiahvyktdrsryelsarewtrkyai

SCOPe Domain Coordinates for d4ii2c1:

Click to download the PDB-style file with coordinates for d4ii2c1.
(The format of our PDB-style files is described here.)

Timeline for d4ii2c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ii2c2