SCOPe 2.05: Domain d2zu1b_: 2zu1 B:

Lineage for d2zu1b_ (2zu1 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species Human coxsackievirus B3 [TaxId:12072] [188738] (7 PDB entries)

8. Domain d2zu1b_: 2zu1 B: [196614]
   automated match to d2vb0a_
   mutant

Details for d2zu1b_

PDB Entry: 2zu1, 1.38 Å

PDB Description: crystal structure of cvb3 3c protease mutant c147a

PDB Compounds: (B:) 3C proteinase

SCOPe Domain Sequences for d2zu1b_:

Sequence; same for both SEQRES and ATOM records:

>d2zu1b_ b.47.1.4 (B:) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqaggvlmstgkvlgihvggnghqgfsaallkhyfn

Timeline for d2zu1b_:

• d2zu1b_ first appeared in SCOPe 2.02
  
• d2zu1b_ appears in SCOPe 2.04
  
• d2zu1b_ appears in SCOPe 2.06
  
• d2zu1b_ appears in the current release, SCOPe 2.08