![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily) consists of four 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) ![]() |
![]() | Family b.66.1.0: automated matches [196610] (1 protein) not a true family |
![]() | Protein automated matches [196611] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196612] (6 PDB entries) |
![]() | Domain d3c7xa_: 3c7x A: [196613] automated match to d1gena_ complexed with cl, na |
PDB Entry: 3c7x (more details), 1.7 Å
SCOPe Domain Sequences for d3c7xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c7xa_ b.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pnicdgnfdtvamlrgemfvfkerwfwrvrnnqvmdgypmpigqfwrglpasintayerk dgkfvffkgdkhwvfdeaslepgypkhikelgrglptdkidaalfwmpngktyffrgnky yrfneelravdseypknikvwegipesprgsfmgsdevftyfykgnkywkfnnqklkvep gypksalrdwmgcpsg
Timeline for d3c7xa_: