Lineage for d3c7xa_ (3c7x A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326101Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 1326102Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 1326137Family b.66.1.0: automated matches [196610] (1 protein)
    not a true family
  6. 1326138Protein automated matches [196611] (1 species)
    not a true protein
  7. 1326139Species Human (Homo sapiens) [TaxId:9606] [196612] (1 PDB entry)
  8. 1326140Domain d3c7xa_: 3c7x A: [196613]
    automated match to d1gena_
    complexed with cl, na

Details for d3c7xa_

PDB Entry: 3c7x (more details), 1.7 Å

PDB Description: hemopexin-like domain of matrix metalloproteinase 14
PDB Compounds: (A:) Matrix metalloproteinase-14

SCOPe Domain Sequences for d3c7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c7xa_ b.66.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pnicdgnfdtvamlrgemfvfkerwfwrvrnnqvmdgypmpigqfwrglpasintayerk
dgkfvffkgdkhwvfdeaslepgypkhikelgrglptdkidaalfwmpngktyffrgnky
yrfneelravdseypknikvwegipesprgsfmgsdevftyfykgnkywkfnnqklkvep
gypksalrdwmgcpsg

SCOPe Domain Coordinates for d3c7xa_:

Click to download the PDB-style file with coordinates for d3c7xa_.
(The format of our PDB-style files is described here.)

Timeline for d3c7xa_: