Lineage for d3caoa_ (3cao A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) Protein Cytochrome c3 [48697] (5 species) 
Species Desulfovibrio africanus [TaxId:873] [48701] (2 PDB entries) 
Domain d3caoa_: 3cao A: [19661]
Details for d3caoa_
PDB Entry: 3cao (more details), 1.6 Å
PDB Description: oxidised structure of the acidic cytochrome c3 from desulfovibrio africanus
SCOP Domain Sequences for d3caoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3caoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus}
edmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcsd
chaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn
SCOP Domain Coordinates for d3caoa_:
Click to download the PDB-style file with coordinates for d3caoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3caoa_:
- d3caoa_ appears in SCOP 1.57
- d3caoa_ appears in the current release, SCOPe 2.08
View in 3D