Lineage for d3caoa_ (3cao A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734176Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 2734179Species Desulfovibrio africanus [TaxId:873] [48701] (2 PDB entries)
  8. 2734180Domain d3caoa_: 3cao A: [19661]
    complexed with ars, hem, zn

Details for d3caoa_

PDB Entry: 3cao (more details), 1.6 Å

PDB Description: oxidised structure of the acidic cytochrome c3 from desulfovibrio africanus
PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d3caoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3caoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus [TaxId: 873]}
xedmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcs
dchaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn

SCOPe Domain Coordinates for d3caoa_:

Click to download the PDB-style file with coordinates for d3caoa_.
(The format of our PDB-style files is described here.)

Timeline for d3caoa_: