![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
![]() | Species Desulfovibrio africanus [TaxId:873] [48701] (2 PDB entries) |
![]() | Domain d3caoa_: 3cao A: [19661] complexed with ars, hem, zn |
PDB Entry: 3cao (more details), 1.6 Å
SCOPe Domain Sequences for d3caoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3caoa_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio africanus [TaxId: 873]} xedmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcs dchaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn
Timeline for d3caoa_: