SCOPe 2.02: Domain d2w9jb_: 2w9j B:

Lineage for d2w9jb_ (2w9j B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
   (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta

4. Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (2 families)

5. Family d.49.1.0: automated matches [196602] (1 protein)
   not a true family

6. Protein automated matches [196603] (1 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:4896] [196604] (1 PDB entry)

8. Domain d2w9jb_: 2w9j B: [196605]
   automated match to d1e8ob_

Details for d2w9jb_

PDB Entry: 2w9j, 2.6 Å

PDB Description: the crystal structure of srp14 from the schizosaccharomyces pombe signal recognition particle

PDB Compounds: (B:) signal recognition particle subunit srp14

SCOPe Domain Sequences for d2w9jb_:

Sequence, based on SEQRES records:

>d2w9jb_ d.49.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 4896]}
mllsneeflkkltdllqthqskgtgsvylsqkcnpvdegegssasvliraksgaaekist
vveldyftdffqsyaevckgqivg

Sequence, based on observed residues (ATOM records):

>d2w9jb_ d.49.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 4896]}
mllsneeflkkltdllqthqskgtgsvylsqkcnpvdegssasvliraksgaaekistvv
eldyftdffqsyaevckgqivg

Timeline for d2w9jb_:

• d2w9jb_ is new in SCOPe 2.02-stable
  
• d2w9jb_ appears in SCOPe 2.03
  
• d2w9jb_ appears in the current release, SCOPe 2.08