Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily) (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta |
Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (2 families) |
Family d.49.1.0: automated matches [196602] (1 protein) not a true family |
Protein automated matches [196603] (1 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:4896] [196604] (1 PDB entry) |
Domain d2w9jb_: 2w9j B: [196605] automated match to d1e8ob_ |
PDB Entry: 2w9j (more details), 2.6 Å
SCOPe Domain Sequences for d2w9jb_:
Sequence, based on SEQRES records: (download)
>d2w9jb_ d.49.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 4896]} mllsneeflkkltdllqthqskgtgsvylsqkcnpvdegegssasvliraksgaaekist vveldyftdffqsyaevckgqivg
>d2w9jb_ d.49.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 4896]} mllsneeflkkltdllqthqskgtgsvylsqkcnpvdegssasvliraksgaaekistvv eldyftdffqsyaevckgqivg
Timeline for d2w9jb_: