Lineage for d3e6yb_ (3e6y B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007267Protein automated matches [190238] (9 species)
    not a true protein
  7. 2007332Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187162] (2 PDB entries)
  8. 2007333Domain d3e6yb_: 3e6y B: [196599]
    automated match to d2o98a_
    complexed with cl, cw1

Details for d3e6yb_

PDB Entry: 3e6y (more details), 2.5 Å

PDB Description: structure of 14-3-3 in complex with the differentiation-inducing agent cotylenin a
PDB Compounds: (B:) 14-3-3-like protein c

SCOPe Domain Sequences for d3e6yb_:

Sequence, based on SEQRES records: (download)

>d3e6yb_ a.118.7.1 (B:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
aptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarr
aswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgds
kvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnf
svfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

Sequence, based on observed residues (ATOM records): (download)

>d3e6yb_ a.118.7.1 (B:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
aptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarr
aswriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgds
kvfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnf
svfyyeilnspdracnlakqafdeaiaeeesykdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d3e6yb_:

Click to download the PDB-style file with coordinates for d3e6yb_.
(The format of our PDB-style files is described here.)

Timeline for d3e6yb_: