SCOPe 2.04: Domain d3gjua_: 3gju A:

Lineage for d3gjua_ (3gju A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (83 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:266835] [196595] (1 PDB entry)

8. Domain d3gjua_: 3gju A: [196596]
   automated match to d3drda_
   complexed with mpd, plp

Details for d3gjua_

PDB Entry: 3gju, 1.55 Å

PDB Description: crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution

PDB Compounds: (A:) Putative aminotransferase

SCOPe Domain Sequences for d3gjua_:

Sequence; same for both SEQRES and ATOM records:

>d3gjua_ c.67.1.0 (A:) automated matches {Mesorhizobium loti [TaxId: 266835]}
gmlnqsnelnawdrdhffhpsthmgthargesptrimaggegvtvwdnngrksidafagl
ycvnvgygrqkiadaiatqaknlayyhayvghgteasitlakmiidrapkgmsrvyfgls
gsdanetnikliwyynnvlgrpekkkiisrwrgyhgsgvmtgsltgldlfhnafdlprap
vlhteapyyfrrtdrsmseeqfsqhcadkleemilaegpetiaafigepilgtggivppp
agywekiqavlkkydvllvadevvtgfgrlgtmfgsdhygikpdlitiakgltsayapls
gvivadrvwqvlvqgsdklgslghgwtysahpicvaagvanlelidemdlvtnagetgay
fraelakavgghknvgevrgdgmlaavefvadkddrvffdasqkigpqvatalaasgvig
rampqgdilgfapplcltreqadivvsktadavksvfa

Timeline for d3gjua_:

• d3gjua_ first appeared in SCOPe 2.02
  
• d3gjua_ appears in SCOPe 2.03
  
• d3gjua_ appears in SCOPe 2.05
  
• d3gjua_ appears in the current release, SCOPe 2.08, called d3gjua1