Lineage for d3gjua_ (3gju A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614644Species Mesorhizobium loti [TaxId:266835] [196595] (1 PDB entry)
  8. 1614645Domain d3gjua_: 3gju A: [196596]
    automated match to d3drda_
    complexed with mpd, plp

Details for d3gjua_

PDB Entry: 3gju (more details), 1.55 Å

PDB Description: crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
PDB Compounds: (A:) Putative aminotransferase

SCOPe Domain Sequences for d3gjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gjua_ c.67.1.0 (A:) automated matches {Mesorhizobium loti [TaxId: 266835]}
gmlnqsnelnawdrdhffhpsthmgthargesptrimaggegvtvwdnngrksidafagl
ycvnvgygrqkiadaiatqaknlayyhayvghgteasitlakmiidrapkgmsrvyfgls
gsdanetnikliwyynnvlgrpekkkiisrwrgyhgsgvmtgsltgldlfhnafdlprap
vlhteapyyfrrtdrsmseeqfsqhcadkleemilaegpetiaafigepilgtggivppp
agywekiqavlkkydvllvadevvtgfgrlgtmfgsdhygikpdlitiakgltsayapls
gvivadrvwqvlvqgsdklgslghgwtysahpicvaagvanlelidemdlvtnagetgay
fraelakavgghknvgevrgdgmlaavefvadkddrvffdasqkigpqvatalaasgvig
rampqgdilgfapplcltreqadivvsktadavksvfa

SCOPe Domain Coordinates for d3gjua_:

Click to download the PDB-style file with coordinates for d3gjua_.
(The format of our PDB-style files is described here.)

Timeline for d3gjua_: