![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
![]() | Species Desulfovibrio gigas [TaxId:879] [48700] (3 PDB entries) |
![]() | Domain d1qn0a_: 1qn0 A: [19659] complexed with hec |
PDB Entry: 1qn0 (more details)
SCOPe Domain Sequences for d1qn0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qn0a_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio gigas [TaxId: 879]} vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhqpgdkqyagcttdgchnildk adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachps
Timeline for d1qn0a_: