SCOPe 2.06: Domain d3guyh1: 3guy H:2-220

Lineage for d3guyh1 (3guy H:2-220)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:419109] [196586] (1 PDB entry)

8. Domain d3guyh1: 3guy H:2-220 [196587]
   Other proteins in same PDB: d3guya2, d3guyb2, d3guyb3, d3guyc2, d3guyc3, d3guyd2, d3guyd3, d3guye2, d3guyf2, d3guyg2, d3guyg3, d3guyh2
   automated match to d3l6ea_

Details for d3guyh1

PDB Entry: 3guy, 1.9 Å

PDB Description: crystal structure of a short-chain dehydrogenase/reductase from vibrio parahaemolyticus

PDB Compounds: (H:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3guyh1:

Sequence, based on SEQRES records:

>d3guyh1 c.2.1.0 (H:2-220) automated matches {Vibrio parahaemolyticus [TaxId: 419109]}
ivitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqeve
qlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqpv
nvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefwet
sgksldtssfmsaedaalmihgalanigngyvsditvnr

Sequence, based on observed residues (ATOM records):

>d3guyh1 c.2.1.0 (H:2-220) automated matches {Vibrio parahaemolyticus [TaxId: 419109]}
ivitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqeve
qlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqpv
nvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefwfm
saedaalmihgalanigngyvsditvnr

Timeline for d3guyh1:

• d3guyh1 first appeared in SCOPe 2.02, called d3guyh_
  
• d3guyh1 was called d3guyh_ in SCOPe 2.05
  
• d3guyh1 appears in SCOPe 2.07
  
• d3guyh1 appears in the current release, SCOPe 2.08