Lineage for d3guyh1 (3guy H:2-220)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096412Species Vibrio parahaemolyticus [TaxId:419109] [196586] (1 PDB entry)
  8. 2096420Domain d3guyh1: 3guy H:2-220 [196587]
    Other proteins in same PDB: d3guya2, d3guyb2, d3guyb3, d3guyc2, d3guyc3, d3guyd2, d3guyd3, d3guye2, d3guyf2, d3guyg2, d3guyg3, d3guyh2
    automated match to d3l6ea_

Details for d3guyh1

PDB Entry: 3guy (more details), 1.9 Å

PDB Description: crystal structure of a short-chain dehydrogenase/reductase from vibrio parahaemolyticus
PDB Compounds: (H:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3guyh1:

Sequence, based on SEQRES records: (download)

>d3guyh1 c.2.1.0 (H:2-220) automated matches {Vibrio parahaemolyticus [TaxId: 419109]}
ivitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqeve
qlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqpv
nvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefwet
sgksldtssfmsaedaalmihgalanigngyvsditvnr

Sequence, based on observed residues (ATOM records): (download)

>d3guyh1 c.2.1.0 (H:2-220) automated matches {Vibrio parahaemolyticus [TaxId: 419109]}
ivitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqeve
qlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqpv
nvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefwfm
saedaalmihgalanigngyvsditvnr

SCOPe Domain Coordinates for d3guyh1:

Click to download the PDB-style file with coordinates for d3guyh1.
(The format of our PDB-style files is described here.)

Timeline for d3guyh1: