Lineage for d3h02f_ (3h02 F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100539Species Salmonella typhimurium [TaxId:602] [196582] (1 PDB entry)
  8. 2100545Domain d3h02f_: 3h02 F: [196583]
    automated match to d2uzfa_
    complexed with bct, so4

Details for d3h02f_

PDB Entry: 3h02 (more details), 2.15 Å

PDB Description: 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
PDB Compounds: (F:) naphthoate synthase

SCOPe Domain Sequences for d3h02f_:

Sequence, based on SEQRES records: (download)

>d3h02f_ c.14.1.0 (F:) automated matches {Salmonella typhimurium [TaxId: 602]}
detmlyapvewhdcsegytdiryekstdgiakitinrpqvrnafrpltvkemiqaladar
yddnvgviiltgegdkafcaggdqkvrgdyggyqddsgvhhlnvldfqrqirtcpkpvva
mvagysiggghvlhmmcdltiaaenaifgqtgpkvgsfdggwgasymarivgqkkareiw
flcrqydaqqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqa
glqelagnatmlfymt

Sequence, based on observed residues (ATOM records): (download)

>d3h02f_ c.14.1.0 (F:) automated matches {Salmonella typhimurium [TaxId: 602]}
detmlyapvewhdcsegytdiryekstdgiakitinrpqvrnafrpltvkemiqaladar
yddnvgviiltgegdkafcaggdhlnvldfqrqirtcpkpvvamvagysiggghvlhmmc
dltiaaenaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydaqqaldmglv
ntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfymt

SCOPe Domain Coordinates for d3h02f_:

Click to download the PDB-style file with coordinates for d3h02f_.
(The format of our PDB-style files is described here.)

Timeline for d3h02f_: