Lineage for d1wad__ (1wad -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) Protein Cytochrome c3 [48697] (5 species) 
Species Desulfovibrio gigas [TaxId:879] [48700] (3 PDB entries) 
Domain d1wad__: 1wad - [19658]
Details for d1wad__
PDB Entry: 1wad (more details), 1.8 Å
PDB Description: cytochrome c3 with 4 heme groups and one calcium ion
SCOP Domain Sequences for d1wad__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wad__ a.138.1.1 (-) Cytochrome c3 {Desulfovibrio gigas}
vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhdpgdkqyagcttdgchnildk
adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachp
SCOP Domain Coordinates for d1wad__:
Click to download the PDB-style file with coordinates for d1wad__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wad__:
- d1wad__ appears in SCOP 1.57
- d1wad__ appears in the current release, SCOPe 2.08, called d1wada_
View in 3D