SCOPe 2.08: Domain d1wada_: 1wad A:

Lineage for d1wada_ (1wad A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio gigas [TaxId:879] [48700] (3 PDB entries)

8. Domain d1wada_: 1wad A: [19658]
   complexed with ca, hem

Details for d1wada_

PDB Entry: 1wad, 1.8 Å

PDB Description: cytochrome c3 with 4 heme groups and one calcium ion

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d1wada_:

Sequence; same for both SEQRES and ATOM records:

>d1wada_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio gigas [TaxId: 879]}
vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhdpgdkqyagcttdgchnildk
adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachp

Timeline for d1wada_:

• d1wada_ first appeared (with stable ids) in SCOP 1.55, called d1wad__
  
• d1wada_ appears in SCOPe 2.07