Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
Species Desulfovibrio gigas [TaxId:879] [48700] (3 PDB entries) |
Domain d1wada_: 1wad A: [19658] complexed with ca, hem |
PDB Entry: 1wad (more details), 1.8 Å
SCOPe Domain Sequences for d1wada_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wada_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio gigas [TaxId: 879]} vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhdpgdkqyagcttdgchnildk adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachp
Timeline for d1wada_: