Lineage for d3h14a1 (3h14 A:4-382)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132897Species Silicibacter pomeroyi [TaxId:246200] [196577] (1 PDB entry)
  8. 2132898Domain d3h14a1: 3h14 A:4-382 [196578]
    Other proteins in same PDB: d3h14a2
    automated match to d2z61a_
    complexed with gol

Details for d3h14a1

PDB Entry: 3h14 (more details), 1.9 Å

PDB Description: crystal structure of a putative aminotransferase from silicibacter pomeroyi
PDB Compounds: (A:) Aminotransferase, classes I and II

SCOPe Domain Sequences for d3h14a1:

Sequence, based on SEQRES records: (download)

>d3h14a1 c.67.1.0 (A:4-382) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
knssrsavdpfivmdvmeaarraeeagrriihmevgqpgtgaprgavealaksletdalg
ytvalglpalrqriarlygewygvdldpgrvvitpgssggfllaftalfdsgdrvgigap
gypsyrqilralglvpvdlptapenrlqpvpadfagldlaglmvaspanptgtmldhaam
galieaaqaqgasfisdeiyhgieyeakavtaleltdecyvinsfskyfsmtgwrvgwmv
vpedqvrvveriaqnmficaphasqvaalaaldcdaelqanldvykanrklmlerlpkag
ftriappdgafyvyadvsdltddsrafaaeilekagvavtpgldfdpergagtlrfsyar
atadieegldrleafmqar

Sequence, based on observed residues (ATOM records): (download)

>d3h14a1 c.67.1.0 (A:4-382) automated matches {Silicibacter pomeroyi [TaxId: 246200]}
knssrsavdpfivmdvmeaarraeeagrriihmevgqpgtgaprgavealaksleglpal
rqriarlygewygvdldpgrvvitpgssggfllaftalfdsgdrvgigapgypsyrqilr
alglvpvdlptapenrlqpvpadfagldlaglmvaspanptgtmldhaamgalieaaqaq
gasfisdeiyhgieyeakavtaleltdecyvinsfskyfsmtgwrvgwmvvpedqvrvve
riaqnmficaphasqvaalaaldcdaelqanldvykanrklmlerlpkagftriappdga
fyvyadvsdltddsrafaaeilekagvavtpgldfdpergagtlrfsyaratadieegld
rleafmqar

SCOPe Domain Coordinates for d3h14a1:

Click to download the PDB-style file with coordinates for d3h14a1.
(The format of our PDB-style files is described here.)

Timeline for d3h14a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h14a2