Lineage for d3h7tb_ (3h7t B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798525Species Sarcoptes scabiei [TaxId:197185] [188883] (2 PDB entries)
  8. 2798529Domain d3h7tb_: 3h7t B: [196574]
    automated match to d3h7oa_
    complexed with zn

Details for d3h7tb_

PDB Entry: 3h7t (more details), 2 Å

PDB Description: crystal structure of scabies mite inactivated protease paralogue s-d1 (smipp-s-d1)
PDB Compounds: (B:) Group 3 allergen SMIPP-S YvT004A06

SCOPe Domain Sequences for d3h7tb_:

Sequence, based on SEQRES records: (download)

>d3h7tb_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]}
iiggkksditkepwavgvlvdekpfcggsiltanfvitaaqcvdgtkpsdisihygssyr
ttkgtsvmakkiyivryhpltmqnnyavietempiklddkttkkielpsllydpepdtsv
lvsgwgstnfksleysgdlmeanftvvdrksceeqykqieadkyiydgvfcaggeydety
igygdagdpavqngtlvgvasyissmpsefpsvflrvgyyvldikdiisgkvkpq

Sequence, based on observed residues (ATOM records): (download)

>d3h7tb_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]}
iiggkksditkepwavgvlvdekpfcggsiltanfvitaaqcvdgtkpsdisihygssyr
ttkgtsvmakkiyivryhpltmqnnyavietempiklddkttkkielpsllydpepdtsv
lvsgwgstnfksleysgdlmeanftvvdrksceeqykqieadkyiydgvfcaggeetyig
ygdagdpavqngtlvgvasyissmpsefpsvflrvgyyvldikdiisgkvkpq

SCOPe Domain Coordinates for d3h7tb_:

Click to download the PDB-style file with coordinates for d3h7tb_.
(The format of our PDB-style files is described here.)

Timeline for d3h7tb_: