Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Sarcoptes scabiei [TaxId:197185] [188883] (2 PDB entries) |
Domain d3h7tb_: 3h7t B: [196574] automated match to d3h7oa_ complexed with zn |
PDB Entry: 3h7t (more details), 2 Å
SCOPe Domain Sequences for d3h7tb_:
Sequence, based on SEQRES records: (download)
>d3h7tb_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]} iiggkksditkepwavgvlvdekpfcggsiltanfvitaaqcvdgtkpsdisihygssyr ttkgtsvmakkiyivryhpltmqnnyavietempiklddkttkkielpsllydpepdtsv lvsgwgstnfksleysgdlmeanftvvdrksceeqykqieadkyiydgvfcaggeydety igygdagdpavqngtlvgvasyissmpsefpsvflrvgyyvldikdiisgkvkpq
>d3h7tb_ b.47.1.0 (B:) automated matches {Sarcoptes scabiei [TaxId: 197185]} iiggkksditkepwavgvlvdekpfcggsiltanfvitaaqcvdgtkpsdisihygssyr ttkgtsvmakkiyivryhpltmqnnyavietempiklddkttkkielpsllydpepdtsv lvsgwgstnfksleysgdlmeanftvvdrksceeqykqieadkyiydgvfcaggeetyig ygdagdpavqngtlvgvasyissmpsefpsvflrvgyyvldikdiisgkvkpq
Timeline for d3h7tb_: