| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:1902] [196367] (2 PDB entries) |
| Domain d3eyyb_: 3eyy B: [196572] automated match to d2o03a_ complexed with cl, edo, mli, ni, zn |
PDB Entry: 3eyy (more details), 2.4 Å
SCOPe Domain Sequences for d3eyyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eyyb_ a.4.5.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
stdwksdlrqrgyrltpqrqlvleavdtlehatpddilgevrktasginistvyrtlell
eelglvshahlghgaptyhladrhhhihlvcrdctnvieadlsvaadftaklreqfgfdt
dmkhfaifgrces
Timeline for d3eyyb_: