Lineage for d3eyyb_ (3eyy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695126Species Streptomyces coelicolor [TaxId:1902] [196367] (2 PDB entries)
  8. 2695128Domain d3eyyb_: 3eyy B: [196572]
    automated match to d2o03a_
    complexed with cl, edo, mli, ni, zn

Details for d3eyyb_

PDB Entry: 3eyy (more details), 2.4 Å

PDB Description: Structural basis for the specialization of Nur, a nickel-specific Fur homologue, in metal sensing and DNA recognition
PDB Compounds: (B:) Putative iron uptake regulatory protein

SCOPe Domain Sequences for d3eyyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eyyb_ a.4.5.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
stdwksdlrqrgyrltpqrqlvleavdtlehatpddilgevrktasginistvyrtlell
eelglvshahlghgaptyhladrhhhihlvcrdctnvieadlsvaadftaklreqfgfdt
dmkhfaifgrces

SCOPe Domain Coordinates for d3eyyb_:

Click to download the PDB-style file with coordinates for d3eyyb_.
(The format of our PDB-style files is described here.)

Timeline for d3eyyb_: