SCOPe 2.08: Domain d3hd5c1: 3hd5 C:29-208

Lineage for d3hd5c1 (3hd5 C:29-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Bordetella parapertussis [TaxId:519] [196569] (1 PDB entry)

8. Domain d3hd5c1: 3hd5 C:29-208 [196570]
   Other proteins in same PDB: d3hd5a2, d3hd5b2, d3hd5c2
   automated match to d3h93a_

Details for d3hd5c1

PDB Entry: 3hd5, 2.35 Å

PDB Description: crystal structure of a thiol:disulfide interchange protein dsba from bordetella parapertussis

PDB Compounds: (C:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3hd5c1:

Sequence; same for both SEQRES and ATOM records:

>d3hd5c1 c.47.1.0 (C:29-208) automated matches {Bordetella parapertussis [TaxId: 519]}
gaqqyvninppmpsdtpgkievleffaytcphcaaiepmvedwaktapqdvvlkqvpiaf
nagmkplqqlyytlqalerpdlhpkvftaihterkrlfdkkamgewaasqgvdrakfdsv
fdsfsvqtqvqrasqlaeaahidgtpafavggrymtspvlagndyagalkvvdqlivqsr

Timeline for d3hd5c1:

• d3hd5c1 first appeared in SCOPe 2.02, called d3hd5c_
  
• d3hd5c1 appears in SCOPe 2.07