Lineage for d3hdpa_ (3hdp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942914Species Clostridium acetobutylicum [TaxId:1488] [193388] (2 PDB entries)
  8. 2942915Domain d3hdpa_: 3hdp A: [196568]
    automated match to d3rmua_
    complexed with ni

Details for d3hdpa_

PDB Entry: 3hdp (more details), 2.06 Å

PDB Description: crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum
PDB Compounds: (A:) Glyoxalase-I

SCOPe Domain Sequences for d3hdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdpa_ d.32.1.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]}
shmslkvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvap
dgedspinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflf
stdigliellek

SCOPe Domain Coordinates for d3hdpa_:

Click to download the PDB-style file with coordinates for d3hdpa_.
(The format of our PDB-style files is described here.)

Timeline for d3hdpa_: