Lineage for d3hinb_ (3hin B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854246Species Rhodopseudomonas palustris [TaxId:1076] [196563] (1 PDB entry)
  8. 2854248Domain d3hinb_: 3hin B: [196564]
    automated match to d3q0jd_

Details for d3hinb_

PDB Entry: 3hin (more details), 2 Å

PDB Description: crystal structure of putative enoyl-coa hydratase from rhodopseudomonas palustris cga009
PDB Compounds: (B:) Putative 3-hydroxybutyryl-CoA dehydratase

SCOPe Domain Sequences for d3hinb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hinb_ c.14.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
tiadpstlvvdtvgpvltiglnrpkkrnalndglmaalkdcltdipdqiravvihgigdh
fsagldlselrerdateglvhsqtwhrvfdkiqycrvpviaalkgaviggglelacaahi
rvaeasayyalpegsrgifvggggsvrlprligvarmadmmltgrvysaaegvvhgfsqy
liengsaydkalelgnrvaqnapltnfavlqalpmiaeanpqtgllmeslmatvaqsdqe
aktrirafldh

SCOPe Domain Coordinates for d3hinb_:

Click to download the PDB-style file with coordinates for d3hinb_.
(The format of our PDB-style files is described here.)

Timeline for d3hinb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3hina_