Lineage for d3hmfa1 (3hmf A:178-291)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1993960Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)
  8. 1994027Domain d3hmfa1: 3hmf A:178-291 [196562]
    Other proteins in same PDB: d3hmfa2
    automated match to d3uvda_
    complexed with cl, edo, zn

Details for d3hmfa1

PDB Entry: 3hmf (more details), 1.63 Å

PDB Description: Crystal Structure of the second Bromodomain of Human Poly-bromodomain containing protein 1 (PB1)
PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d3hmfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmfa1 a.29.2.0 (A:178-291) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlktiaqri
qngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhe

SCOPe Domain Coordinates for d3hmfa1:

Click to download the PDB-style file with coordinates for d3hmfa1.
(The format of our PDB-style files is described here.)

Timeline for d3hmfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hmfa2