SCOPe 2.06: Domain d3hs3b1: 3hs3 B:57-318

Lineage for d3hs3b1 (3hs3 B:57-318)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Lactobacillus acidophilus [TaxId:1579] [196560] (1 PDB entry)

8. Domain d3hs3b1: 3hs3 B:57-318 [196561]
   Other proteins in same PDB: d3hs3a2, d3hs3b2
   automated match to d3c3ka_

Details for d3hs3b1

PDB Entry: 3hs3, 1.6 Å

PDB Description: crystal structure of periplasmic binding ribose operon repressor protein from lactobacillus acidophilus

PDB Compounds: (B:) Ribose operon repressor

SCOPe Domain Sequences for d3hs3b1:

Sequence; same for both SEQRES and ATOM records:

>d3hs3b1 c.93.1.0 (B:57-318) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
kkskmigiiipdlnnrfyaqiidgiqeviqkegytalisfstnsdvkkyqnaiinfennn
vdgiitsaftippnfhlntplvmydsaninddivrivsnntkggkesikllskkiekvli
qhwplslptirerieamtaeasklkidylleetpennpyisaqsalnksnqfdaiitvnd
lyaaeiikeakrrnlkipddfqlvgydnnilcgytsptistidqnpkligqtaahrlldl
msgnnstrnsiidvlpikrdst

Timeline for d3hs3b1:

• d3hs3b1 first appeared in SCOPe 2.02, called d3hs3b_
  
• d3hs3b1 was called d3hs3b_ in SCOPe 2.05
  
• d3hs3b1 appears in SCOPe 2.07
  
• d3hs3b1 appears in the current release, SCOPe 2.08