Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d1mdvb_ (1mdv B:)

  1. Root: SCOP 1.75
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. Family a.138.1.1: Cytochrome c3-like [48696] (4 protein domains)
  6. Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. Species Desulfovibrio vulgaris [TaxId:881] [48699] (11 PDB entries)
    Uniprot P00132
  8. Domain d1mdvb_: 1mdv B: [19656]
    complexed with hem; mutant

Details for d1mdvb_

PDB Entry: 1mdv (more details)
PDB Description: key role of phenylalanine 20 in cytochrome c3: structure, st and function studies
PDB Compounds: (B:) cytochrome c3

SCOP Domain Sequences for d1mdvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdvb_ a.138.1.1 (B:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
glkmeatkqpvvlnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdksakgyyh
vmhdkntkfkscvgchvevagadaakkkdltgckkskche

SCOP Domain Coordinates for d1mdvb_:

Click to download the PDB-style file with coordinates for d1mdvb_.
(The format of our PDB-style files is described here.)

Timeline for d1mdvb_:

d1mdvb_ appears in SCOP 1.73
d1mdvb_ appears in SCOP 1.75A


d1mdvb_
(click for larger image)


d1mdvb_ in context of chain



d1mdvb_ in context of PDB
Domains from other chains:
d1mdva_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu