Lineage for d3dvwa_ (3dvw A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370656Species Neisseria meningitidis [TaxId:122586] [196549] (3 PDB entries)
  8. 1370658Domain d3dvwa_: 3dvw A: [196557]
    automated match to d3h93a_

Details for d3dvwa_

PDB Entry: 3dvw (more details), 1.5 Å

PDB Description: Crystal structure of reduced DsbA1 from Neisseria meningitidis
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3dvwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvwa_ c.47.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
paglvegqnytvlanpipqqqagkvevleffgyfcphcahlepvlskhaksfkddmylrt
ehvvwqkemltlarlaaavdmaaadskdvanshifdamvnqkiklqnpevlkkwlgeqta
fdgkkvlaayespesqaradkmqeltetfqidgtptvivggkykvefadwesgmntidll
adkvreeqkaa

SCOPe Domain Coordinates for d3dvwa_:

Click to download the PDB-style file with coordinates for d3dvwa_.
(The format of our PDB-style files is described here.)

Timeline for d3dvwa_: