SCOPe 2.05: Domain d3gcea_: 3gce A:

Lineage for d3gcea_ (3gce A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (10 species)
   not a true protein

7. Species Nocardioides aromaticivorans [TaxId:200618] [196555] (2 PDB entries)

8. Domain d3gcea_: 3gce A: [196556]
   automated match to d2i7fa_
   complexed with fes

Details for d3gcea_

PDB Entry: 3gce, 2 Å

PDB Description: Ferredoxin of carbazole 1,9a-dioxygenase from Nocardioides aromaticivorans IC177

PDB Compounds: (A:) Ferredoxin component of carbazole 1,9a-dioxygenase

SCOPe Domain Sequences for d3gcea_:

Sequence; same for both SEQRES and ATOM records:

>d3gcea_ b.33.1.0 (A:) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
stpvrvatldqlkpgvptafdvdgdevmvvrdgdsvyaisnlcshaeayldmgvfhaesl
eiecplhvgrfdvrtgaptalpcvlpvraydvvvdgteilvapk

Timeline for d3gcea_:

• d3gcea_ first appeared in SCOPe 2.02
  
• d3gcea_ appears in SCOPe 2.04
  
• d3gcea_ appears in SCOPe 2.06
  
• d3gcea_ appears in the current release, SCOPe 2.08