| Class b: All beta proteins [48724] (180 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
| Protein automated matches [190701] (13 species) not a true protein |
| Species Nocardioides aromaticivorans [TaxId:200618] [196555] (2 PDB entries) |
| Domain d3gcea_: 3gce A: [196556] automated match to d2i7fa_ complexed with fes |
PDB Entry: 3gce (more details), 2 Å
SCOPe Domain Sequences for d3gcea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gcea_ b.33.1.0 (A:) automated matches {Nocardioides aromaticivorans [TaxId: 200618]}
stpvrvatldqlkpgvptafdvdgdevmvvrdgdsvyaisnlcshaeayldmgvfhaesl
eiecplhvgrfdvrtgaptalpcvlpvraydvvvdgteilvapk
Timeline for d3gcea_: