| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Anthomedusae sp. [TaxId:328397] [194158] (5 PDB entries) |
| Domain d3gl4b_: 3gl4 B: [196551] automated match to d3lvca_ |
PDB Entry: 3gl4 (more details), 2.15 Å
SCOPe Domain Sequences for d3gl4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gl4b_ d.22.1.0 (B:) automated matches {Anthomedusae sp. [TaxId: 328397]}
eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig
Timeline for d3gl4b_: