SCOPe 2.08: Domain d3iccb1: 3icc B:1-252

Lineage for d3iccb1 (3icc B:1-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [196544] (4 PDB entries)

8. Domain d3iccb1: 3icc B:1-252 [196546]
   Other proteins in same PDB: d3icca2, d3iccb2
   automated match to d3osua_
   complexed with cl, mes, nap, so4

Details for d3iccb1

PDB Entry: 3icc, 1.87 Å

PDB Description: crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution

PDB Compounds: (B:) Putative 3-oxoacyl-(acyl carrier protein) reductase

SCOPe Domain Sequences for d3iccb1:

Sequence; same for both SEQRES and ATOM records:

>d3iccb1 c.2.1.0 (B:1-252) automated matches {Bacillus anthracis [TaxId: 261594]}
mlkgkvalvtgasrgigraiakrlandgalvaihygnrkeeaeetvyeiqsnggsafsig
anleslhgvealyssldnelqnrtgstkfdilinnagigpgafieetteqffdrmvsvna
kapffiiqqalsrlrdnsriinissaatrislpdfiaysmtkgaintmtftlakqlgarg
itvnailpgfvktdmnaellsdpmmkqyattisafnrlgevediadtaaflaspdsrwvt
gqlidvsggscl

Timeline for d3iccb1:

• d3iccb1 first appeared in SCOPe 2.02, called d3iccb_
  
• d3iccb1 appears in SCOPe 2.07