Lineage for d2cym__ (2cym -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) Protein Cytochrome c3 [48697] (5 species) 
Species Desulfovibrio vulgaris [TaxId:881] [48699] (5 PDB entries) 
Domain d2cym__: 2cym - [19654]
Details for d2cym__
PDB Entry: 2cym (more details), 2 Å
PDB Description: effects of amino acid substitution on three-dimensional structure: an x-ray analysis of cytochrome c3 from desulfovibrio vulgaris hildenborough at 2 angstroms resolution
SCOP Domain Sequences for d2cym__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cym__ a.138.1.1 (-) Cytochrome c3 {Desulfovibrio vulgaris}
apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche
SCOP Domain Coordinates for d2cym__:
Click to download the PDB-style file with coordinates for d2cym__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cym__:
- d2cym__ appears in SCOP 1.57
- d2cym__ appears in the current release, SCOPe 2.08, called d2cyma_
View in 3D