Class a: All alpha proteins [46456] (289 folds) |
Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily) multihelical; bundle |
Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) |
Family a.209.1.0: automated matches [191592] (1 protein) not a true family |
Protein automated matches [191071] (2 species) not a true protein |
Species Rhodospirillum rubrum [TaxId:1085] [196535] (3 PDB entries) |
Domain d2wodb_: 2wod B: [196536] automated match to d3g9da_ complexed with cl, gol, mn, zzc |
PDB Entry: 2wod (more details), 2.25 Å
SCOPe Domain Sequences for d2wodb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wodb_ a.209.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 1085]} gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl
Timeline for d2wodb_: