SCOPe 2.07: Domain d2wodb_: 2wod B:

Lineage for d2wodb_ (2wod B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
   multihelical; bundle

4. Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families)

5. Family a.209.1.0: automated matches [191592] (1 protein)
   not a true family

6. Protein automated matches [191071] (2 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:1085] [196535] (3 PDB entries)

8. Domain d2wodb_: 2wod B: [196536]
   automated match to d3g9da_
   complexed with cl, gol, mn, zzc

Details for d2wodb_

PDB Entry: 2wod, 2.25 Å

PDB Description: crystal structure of the dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with adp- ribsoyllysine

PDB Compounds: (B:) ADP-ribosyl-[dinitrogen reductase] glycohydrolase

SCOPe Domain Sequences for d2wodb_:

Sequence; same for both SEQRES and ATOM records:

>d2wodb_ a.209.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl

Timeline for d2wodb_:

• d2wodb_ first appeared in SCOPe 2.02
  
• d2wodb_ appears in SCOPe 2.06
  
• d2wodb_ appears in the current release, SCOPe 2.08