Lineage for d2wodb_ (2wod B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014808Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
    multihelical; bundle
  4. 2014809Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families) (S)
  5. 2014814Family a.209.1.0: automated matches [191592] (1 protein)
    not a true family
  6. 2014815Protein automated matches [191071] (2 species)
    not a true protein
  7. 2014820Species Rhodospirillum rubrum [TaxId:1085] [196535] (3 PDB entries)
  8. 2014828Domain d2wodb_: 2wod B: [196536]
    automated match to d3g9da_
    complexed with cl, gol, mn, zzc

Details for d2wodb_

PDB Entry: 2wod (more details), 2.25 Å

PDB Description: crystal structure of the dinitrogenase reductase-activating glycohydrolase (drag) from rhodospirillum rubrum in complex with adp-ribsoyllysine
PDB Compounds: (B:) ADP-ribosyl-[dinitrogen reductase] glycohydrolase

SCOPe Domain Sequences for d2wodb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wodb_ a.209.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
gpsvhdralgaflglavgdalgatvefmtkgeiaqqygihrkmtgggwlrlkpgqitddt
emslalgrslaakgtldvadiceefalwlksrpvdvgntcrrgirrymhegtttapyseg
dagngaamrclpaalatlghpadlepwvlaqarithnhplsdaacltlgrmvhhliggrg
mkacreeanrlvhqhrdfhfepykgqssayivdtmqtvlhyyfvtdtfkscliqtvnqgg
dadttgalagmlagatygvddipsgwlskldmkvereirrqvdallalagl

SCOPe Domain Coordinates for d2wodb_:

Click to download the PDB-style file with coordinates for d2wodb_.
(The format of our PDB-style files is described here.)

Timeline for d2wodb_: