Lineage for d3jtxb_ (3jtx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132781Species Neisseria meningitidis [TaxId:122587] [196533] (1 PDB entry)
  8. 2132783Domain d3jtxb_: 3jtx B: [196534]
    Other proteins in same PDB: d3jtxa2
    automated match to d3ezsb_
    complexed with act, ca, gol, mes

Details for d3jtxb_

PDB Entry: 3jtx (more details), 1.91 Å

PDB Description: crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d3jtxb_:

Sequence, based on SEQRES records: (download)

>d3jtxb_ c.67.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 122587]}
mntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhelek
ypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpvsdgikp
aivspnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnps
gsvldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmft
slskrsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnrr
lyqekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrflar
dteqgnpgegyvrialvadvatcvkaaedivslyr

Sequence, based on observed residues (ATOM records): (download)

>d3jtxb_ c.67.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 122587]}
mntllkqlkpypfarlheamqgisapegmeavplhigepkhptpkvitdaltaslhelek
ypltaglpelrqacanwlkrrydgltvdadneilpvlgsrealfsfvqtvlnpvgikpai
vspnpfyqiyegatllgggeihfancpapsfnpdwrsiseevwkrtklvfvcspnnpsgs
vldldgwkevfdlqdkygfiiasdecyseiyfdgnkplgclqaaaqlgrsrqkllmftsl
skrsnvpglrsgfvagdaellknfllyrtyhgsamsipvqrasiaawddeqhvidnrrly
qekfervipilqqvfdvklpdasfyiwlkvpdgddlafarnlwqkaaiqvlpgrflardt
eqgnpgegyvrialvadvatcvkaaedivslyr

SCOPe Domain Coordinates for d3jtxb_:

Click to download the PDB-style file with coordinates for d3jtxb_.
(The format of our PDB-style files is described here.)

Timeline for d3jtxb_: