Lineage for d3jvia1 (3jvi A:1-157)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874917Species Entamoeba histolytica [TaxId:294381] [196531] (4 PDB entries)
  8. 2874918Domain d3jvia1: 3jvi A:1-157 [196532]
    Other proteins in same PDB: d3jvia2
    automated match to d2cwdb_
    complexed with so4

Details for d3jvia1

PDB Entry: 3jvi (more details), 1.8 Å

PDB Description: product state mimic crystal structure of protein tyrosine phosphatase from entamoeba histolytica
PDB Compounds: (A:) protein tyrosine phosphatase

SCOPe Domain Sequences for d3jvia1:

Sequence, based on SEQRES records: (download)

>d3jvia1 c.44.1.0 (A:1-157) automated matches {Entamoeba histolytica [TaxId: 294381]}
mkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrkvgks
rgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttiktte
vpdpyyggekgfhrvidiledacenliikleegklin

Sequence, based on observed residues (ATOM records): (download)

>d3jvia1 c.44.1.0 (A:1-157) automated matches {Entamoeba histolytica [TaxId: 294381]}
mkllfvclgnicrspaaeavmkkviqnhhltekyicdsagtcsyhegqqadsrmrkvgks
rgyqvdsisrpvvssdfknfdyifamdndnyyelldrcpeqykqkifkmvdfcttiktte
vpdpygekgfhrvidiledacenliikleegklin

SCOPe Domain Coordinates for d3jvia1:

Click to download the PDB-style file with coordinates for d3jvia1.
(The format of our PDB-style files is described here.)

Timeline for d3jvia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jvia2