SCOPe 2.08: Domain d2cthb_: 2cth B:

Lineage for d2cthb_ (2cth B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio vulgaris [TaxId:881] [48699] (18 PDB entries)
   Uniprot P00132

8. Domain d2cthb_: 2cth B: [19653]
   complexed with hem

Details for d2cthb_

PDB Entry: 2cth, 1.67 Å

PDB Description: cytochrome c3 from desulfovibrio vulgaris hildenborough

PDB Compounds: (B:) cytochrome c3

SCOPe Domain Sequences for d2cthb_:

Sequence; same for both SEQRES and ATOM records:

>d2cthb_ a.138.1.1 (B:) Cytochrome c3 {Desulfovibrio vulgaris [TaxId: 881]}
apkapadglkmeatkqpvvfnhsthksvkcgdchhpvngkedyrkcgtagchdsmdkkdk
sakgyyhvmhdkntkfkscvgchvevagadaakkkdltgckkskche

Timeline for d2cthb_:

• d2cthb_ first appeared (with stable ids) in SCOP 1.55
  
• d2cthb_ appears in SCOPe 2.07